***** Informujemy, że w dniach 12.08.2018 - 18.08.2018 sklep będzie nieczynny. Złożone w tym czasie zamówienia będą przez nas niezwłocznie realizowane od poniedziałku 20 sierpnia. *****
 
Aktualnie produktów w Twoim koszyku: 0 szt.
wartość koszyka: 0,00 zł
Zobacz koszyk
OLSZTYŃSKIE INTERNETOWE CENTRUM ZOOLOGICZNE
OLSZTYŃSKIE INTERNETOWE CENTRUM ZOOLOGICZNE
537 450 500
PSY»  KARMY NA WAGĘ»  KARMY SUCHE»  CALISTA»  CANIVERA»  LINCOLN»  BOZITA»  BOZITA ROBUR»  BOZITA ROBUR SENSITIVE»  FARMINA N&D GRAIN FREE CANINE»  FARMINA N&D LOW ANCESTRAL GRAIN CANINE»  FARMINA N&D PUMPKIN GRAIN FREE CANINE»  FARMINA N&D QUINOA CANINE»  JOSERA»  ORIJEN»  ROYAL CANIN BREED (PSY RASOWE)»  ROYAL CANIN CLUB (LINIA SPECJALNA)»  ROYAL CANIN LIFESTYLE»  ROYAL CANIN SIZE (WIELKOŚĆ PSA)»  WIEJSKA ZAGRODA»  BRIT CARE»  BRIT PREMIUM BY NATURE»  ACANA HERITAGE»  ACANA CLASSICS»  ACANA REGIONALS»  ACANA SINGLES»  CALIBRA PREMIUM»  CALIBRA SUPERPREMIUM»  ALPHA SPIRIT»  DOGSHIELD»  TROPIDOG PREMIUM»  FARMINA ECOPET NATURAL»  TASTE OF THE WILD»  VERSELE LAGA OPTI LIFE»  ARKWRIGHTS»  FITMIN FOR LIFE»  1ST CHOICE»  APPLAWS»  ARDEN GRANGE»  ARION HEALTH&CARE»  ARION ORIGINAL»  BOSCH»  CARNILOVE»  DR. JOHN»  ESSENTIAL»  FITMIN»  HILL`S»  NUTRA GOLD»  NUTRA NUGGETS»  PURINA DOG CHOW»  PURINA PRO PLAN»  KARMY MOKRE»  PRZYSMAKI»  MLEKO DLA SZCZENIĄT»  AKCESORIA»  ZABAWKI»  PIELĘGNACJA»  OTOCZENIE»  NA PCHŁY i KLESZCZE»  SUPLEMENTY DIETY i PREPARATY LECZNICZEKOTYGRYZONIEFRETKIPTAKIAKWARYSTYKADIETY WETERYNARYJNESUPLEMENTY DIETYNA PCHŁY i KLESZCZEWYPRZEDAŻ
Logowanie
Koszyk
... jest pusty
Facebook
Gazetka
 
Promocje
Newsletter
Chcesz otrzymywać informacje o promocjach, wyprzedażach i nowościach w naszym sklepie?
E-mail:
BOZITA ROBUR SENSITIVE
Sortuj produkty wg:
Pokaż produkty:
Produkty promocyjne:
Ilość wyników na stronie: 
Wyświetlanie od 1 do 4 (z 4 pozycji) Stron:  1 
 Foto   Nazwa   Producent   Cena   Koszyk 
 
BOZITA ROBUR SENSITIVE GRAIN FREE CHICKEN 11,5KG
 BOZITA ROBUR SENSITIVE GRAIN FREE CHICKEN 11,5KG   BOZITA  Cena:
299,00 zł

Dla dorosłych, wrażliwych psów wszystkich ras i wielkości o poziomie aktywności od normalnego do wysokiego. Dla psów > 1-rocznych | 30% białka, 15% tłuszczu ·         Naturalnie ... 
 
BOZITA ROBUR SENSITIVE GRAIN FREE REINDEER  11,5KG
 BOZITA ROBUR SENSITIVE GRAIN FREE REINDEER 11,5KG   BOZITA  Cena:
299,00 zł

Dla dorosłych, wrażliwych psów wszystkich ras i wielkości o poziomie aktywności od normalnego do wysokiego. Dla psów > 1-rocznych | 26% białka, 16% tłuszczu ·         Naturalnie ... 
 
BOZITA ROBUR SENSITIVE SINGLE PROTEIN SALMON & RICE  12,5KG
 BOZITA ROBUR SENSITIVE SINGLE PROTEIN SALMON & ...   BOZITA  Cena:
249,00 zł

Bozita Robur Sensitive Single Protein Salmon & Rice przeznaczona jest dla dorosłych psów o normalnym poziomie aktywności.   Dla psów > 1-rocznych | 21% białka, 11% ... 
 
BOZITA ROBUR SENSITIVE SINGLE PROTEIN LAMB & RICE 12,5KG
 BOZITA ROBUR SENSITIVE SINGLE PROTEIN LAMB & RICE ...   BOZITA  Cena:
239,00 zł

Bozita Robur Genuine Lamb & Rice przeznaczona jest dla psów dorosłych o normalnym poziomie aktywności. Wyprodukowana przy użyciu jagnięciny jako jedynego źrodła białka zwierzęcego. Doskonale nadaje się dla psów wrażliwych. Dla ... 
Wyświetlanie od 1 do 4 (z 4 pozycji) Stron:  1 
Diego 2011 © Wszelkie prawa zastrzeżone | Kontakt@diego.pl
Projekt i realizacja: 4hosting.pl